PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3675s0017.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 475aa    MW: 53078.8 Da    PI: 6.9774
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3675s0017.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.13.7e-16741135
                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                         C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Cagra.3675s0017.1.p  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                         ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.4E-9153IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-12549No hitNo description
CDDcd002023.90E-17654No hitNo description
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF003206.0E-14741IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.5E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF139191.1E-7236331IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLVNYTPLHS RPEGDELEIE  60
DRKPQRVMIK GMSLNKKIPK KKSYQENFTV KRANLEFSTG FKRKALDEEA SNRSSSGSVV  120
SNSESCAQSN AWETTFPCKR RTGVGRPKAA SSVEKLTKDL YTILQEQQSS CLSGSTEEDL  180
LFENEPPMLL GHGSVLMRDP HSGTREEESE ASSLVVESSK SSSVHSAKFG GKAIKQEQLK  240
RSKPQVLGRQ SLLLCSIDLK DVFNFDEFIE KFTEDEQKKL MKLLPQVDSF DRPDSLRSMF  300
ESSQFKENLS LFQQLVADGV FETSSSGSKH DDVKTLAKLA LTDPNKSHLL ESYKMLKEQR  360
KEIEDSVTTP PRVSNLSPSN NNSLVTVERP CESLNQNFSE TRAVMRSPKE VMKIRSNHTE  420
TKEIIENSVS SFNPMSCGGS LVFRYEDNDI SDQDLLLDVP SNGSFPQAEL LHMI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2266420.0AK226642.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL07-38-K02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010494936.10.0PREDICTED: GATA transcription factor 27 isoform X1
SwissprotQ5PP380.0GAT27_ARATH; GATA transcription factor 27
TrEMBLD7MPX30.0D7MPX3_ARALL; Zinc finger family protein
STRINGfgenesh1_pg.C_scaffold_80000660.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16062785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47140.10.0GATA transcription factor 27